PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ42539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 219aa    MW: 22066.6 Da    PI: 7.6011
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ42539.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.85.2e-17132166135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +Cg+t++p+WRrgp  +++LCnaCG +yr++++
  KXZ42539.1 132 CDHCGATESPQWRRGPPAKPMLCNACGTRYRRTNQ 166
                 9***************99999**********9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.52E-12126173No hitNo description
PROSITE profilePS5011412.848126180IPR000679Zinc finger, GATA-type
SMARTSM004018.9E-11126178IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.1E-13127174IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.98E-12131169No hitNo description
PfamPF003202.7E-14132166IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MQPAQSSDVE LPAQPPCRAA GGEGGNDGSC AEAPDNDCVT SAELQAATGC CGTVATRLVV  60
ETAVGPMSNV QLPADWWQLQ QQLAGGQDWE PESVPVSPAA PVDAGASTMP AAMPAAPVPA  120
ARAFHHKTGG PCDHCGATES PQWRRGPPAK PMLCNACGTR YRRTNQLNPA SANSAAVRAA  180
AAAAAAAAAT AAPSAKGRGA KREGSFCAGA SKRGRSAYY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150FY631e-155A0A150FY63_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.33e-12GATA transcription factor 26